Groups | Search | Server Info | Keyboard shortcuts | Login | Register [http] [https] [nntp] [nntps]

Groups > linux.debian.maint.python > #9885

Re: pycharm package in debian

Path csiph.com!weretis.net!feeder4.news.weretis.net!border2.nntp.ams1.giganews.com!border1.nntp.ams1.giganews.com!nntp.giganews.com!peer03.ams1!peer.ams1.xlned.com!news.xlned.com!newsfeed.xs4all.nl!newsfeed8.news.xs4all.nl!feeder.erje.net!1.eu.feeder.erje.net!news.panservice.it!bofh.it!news.nic.it!robomod
From Julien Puydt <julien.puydt@laposte.net>
Newsgroups linux.debian.maint.python
Subject Re: pycharm package in debian
Date Sat, 30 Sep 2017 16:40:02 +0200
Message-ID <uvr5U-5m8-7@gated-at.bofh.it> (permalink)
References <uvp45-44q-3@gated-at.bofh.it>
X-Original-To kamaraju kusumanchi <raju.mailinglists@gmail.com>, debian-python <debian-python@lists.debian.org>
X-Mailbox-Line From debian-python-request@lists.debian.org Sat Sep 30 14:35:28 2017
Old-Return-Path <julien.puydt@laposte.net>
X-Amavis-Spam-Status No, score=-6.979 tagged_above=-10000 required=5.3 tests=[BAYES_00=-2, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, FOURLA=0.1, FREEMAIL_FROM=0.001, LDO_WHITELIST=-5, RCVD_IN_DNSWL_LOW=-0.7, RP_MATCHES_RCVD=-0.001, SARE_FREE_WEBM_LAPOSTE=0.721] autolearn=ham autolearn_force=no
X-Policyd-Weight DYN_NJABL=ERR(0) NOT_IN_SBL_XBL_SPAMHAUS=-1.5 NOT_IN_BL_NJABL=-1.5 CL_IP_NE_HELO=0.5 (check from: .laposte. - helo: .smtpoutz2.laposte. - helo-domain: .laposte.) CL_HOSTNAME_MATCHES_FROM(DOMAIN)=-1.2; rate: -3.7
Dkim-Signature v=1; a=rsa-sha256; c=simple/simple; d=laposte.net; s=mail0; t=1506782106; bh=22EODD0iDXw+si2ih3H0bbifS/K16aqavk8r1qxT+5c=; h=Subject:To:References:From:Date:In-Reply-To; b=kGLVfWve5qPd4rEZe7zmaOLu3BI8JlFGhP5xfHizQ9P+PTcK5qkshviGjnGrpJtNo IFfzMkTAUNlM4V0tqoFWTsH1sNymkpX0cGCTa3u/SoPJFAxP8XG2FziOBNp9T7e73+ YTDLcPcLHtzi0mAcxEIIK8c8HgRYO+PIxQWzeto+uv5JJ4weMehUDSGFtgj9uxFdRZ 0J9SZBMXcK5pHrdTS5qFUFRr65KN2b8he7Qq1p0QNIqpc6NM1a5dp7XZ5Q5tg7+22+ YgvqYY+Pl0ijttnJm84eK/4ReEfSUMrZrFRJu7YMY9gPW7D3Dw5R5MSrLPQJ5+0jML RlBrtpkBQjiRQ==
User-Agent Mozilla/5.0 (X11; Linux x86_64; rv:52.0) Gecko/20100101 Thunderbird/52.3.0
MIME-Version 1.0
Content-Type text/plain; charset=utf-8
Content-Language fr
Content-Transfer-Encoding 8bit
X-Vr-Srcip 78.203.229.6
X-Vr-Cause-1 gggruggvucftvghtrhhoucdtuddrfeelledrkedtgdejkecutefuodetggdotefrodftvfcurfhrohhf
X-Vr-Cause-2 ihhlvgemucfntefrqffuvffgnecuuegrihhlohhuthemucehtddtnecunecujfgurhepuffvfhfhkfff
X-Vr-Cause-3 fgggjggtgfesthekredttdefjeenucfhrhhomheplfhulhhivghnucfruhihughtuceojhhulhhivghn
X-Vr-Cause-4 rdhpuhihughtsehlrghpohhsthgvrdhnvghtqeenucfkphepjeekrddvtdefrddvvdelrdeinecurfgr
X-Vr-Cause-5 rhgrmhepmhhouggvpehsmhhtphhouhhtpdhhvghloheplgduledvrdduieekrddurdehngdpihhnvght
X-Vr-Cause-6 peejkedrvddtfedrvddvledriedpmhgrihhlfhhrohhmpehjuhhlihgvnhdrphhuhigutheslhgrphho
X-Vr-Cause-7 shhtvgdrnhgvthdprhgtphhtthhopehrrghjuhdrmhgrihhlihhnghhlihhsthhssehgmhgrihhlrdgt
X-Vr-Cause-8 ohhm
X-Vr-Avstate No
X-Mailing-List <debian-python@lists.debian.org> archive/latest/15267
List-ID <debian-python.lists.debian.org>
List-URL <https://lists.debian.org/debian-python/>
List-Archive https://lists.debian.org/msgid-search/5804be2d-67fa-b7d3-1332-8b362f892b5e@laposte.net
Approved robomod@news.nic.it
Lines 11
Organization linux.* mail to news gateway
Sender robomod@news.nic.it
X-Original-Date Sat, 30 Sep 2017 16:35:05 +0200
X-Original-Message-ID <5804be2d-67fa-b7d3-1332-8b362f892b5e@laposte.net>
X-Original-References <CABpbYad0e+JPyoU5F2GF5MoVLF+--BwCCahMS-2TKeJJXZ-M-A@mail.gmail.com>
X-Received-Body-CRC 3030808787
Xref csiph.com linux.debian.maint.python:9885

Show key headers only | View raw

Hi,

Le 30/09/2017 à 14:22, kamaraju kusumanchi a écrit :
> Are there any plans to make a debian package of pycharm that is part
> of official debian? I used their community edition on windows 7 and it
> is awesome.

Maybe you should look at WNPP to see if someone filed a RFP or ITP, and
if not, submit a RFP yourself?

Snark on #debian-python

Back to linux.debian.maint.python | Previous | Next — Previous in thread | Next in thread | Find similar | Unroll thread

Thread

pycharm package in debian kamaraju kusumanchi <raju.mailinglists@gmail.com> - 2017-09-30 14:30 +0200
  Re: pycharm package in debian Yaroslav Halchenko <yoh@onerussian.com> - 2017-09-30 15:40 +0200
  Re: pycharm package in debian Julien Puydt <julien.puydt@laposte.net> - 2017-09-30 16:40 +0200
    Re: pycharm package in debian Paul Wise <pabs@debian.org> - 2017-10-01 03:40 +0200
      Re: pycharm package in debian Ghislain Vaillant <ghisvail@gmail.com> - 2017-10-01 09:30 +0200
        Re: pycharm package in debian Paul Wise <pabs@debian.org> - 2017-10-01 09:40 +0200
          Re: pycharm package in debian Ghislain Vaillant <ghisvail@gmail.com> - 2017-10-01 09:50 +0200
            Re: pycharm package in debian Ben Finney <bignose@debian.org> - 2017-10-01 10:50 +0200
              Re: pycharm package in debian Ghislain Vaillant <ghisvail@gmail.com> - 2017-10-01 11:10 +0200
                Re: pycharm package in debian Ben Finney <bignose@debian.org> - 2017-10-01 11:50 +0200
            Re: pycharm package in debian Thomas Goirand <zigo@debian.org> - 2017-10-01 21:40 +0200
              Re: pycharm package in debian Ghislain Vaillant <ghisvail@gmail.com> - 2017-10-01 22:10 +0200
              Re: pycharm package in debian Matthias Klose <doko@debian.org> - 2017-10-02 00:00 +0200
                Re: pycharm package in debian Thomas Goirand <zigo@debian.org> - 2017-10-02 10:40 +0200
                Re: pycharm package in debian "W. Martin Borgert" <debacle@debian.org> - 2017-10-02 10:50 +0200
                Re: pycharm package in debian Diane Trout <diane@ghic.org> - 2017-10-04 23:20 +0200
                Re: pycharm package in debian Simon McVittie <smcv@debian.org> - 2017-10-04 23:50 +0200
                Re: pycharm package in debian Diane Trout <diane@ghic.org> - 2017-10-05 01:10 +0200
        Re: pycharm package in debian "W. Martin Borgert" <debacle@debian.org> - 2017-10-01 17:00 +0200
          Re: pycharm package in debian Ghislain Vaillant <ghisvail@gmail.com> - 2017-10-01 18:20 +0200
            Re: pycharm package in debian "W. Martin Borgert" <debacle@debian.org> - 2017-10-01 18:40 +0200
              Re: pycharm package in debian Ben Finney <bignose@debian.org> - 2017-10-02 00:10 +0200
              Re: pycharm package in debian Andrey Rahmatullin <wrar@debian.org> - 2017-10-02 00:10 +0200
          Re: pycharm package in debian Andrey Rahmatullin <wrar@debian.org> - 2017-10-01 20:20 +0200
            Re: pycharm package in debian "W. Martin Borgert" <debacle@debian.org> - 2017-10-01 23:20 +0200
        snap in debian Brian May <bam@debian.org> - 2017-10-01 22:50 +0200
          Re: snap in debian Michael Hudson-Doyle <michael.hudson@canonical.com> - 2017-10-04 22:40 +0200
            Re: snap in debian Brian May <bam@debian.org> - 2017-10-04 23:00 +0200
              Re: snap in debian Brian May <bam@debian.org> - 2017-10-04 23:10 +0200
              Re: snap in debian Michael Hudson-Doyle <michael.hudson@canonical.com> - 2017-10-04 23:20 +0200
                Re: snap in debian Michael Hudson-Doyle <michael.hudson@canonical.com> - 2017-10-09 01:50 +0200
                Re: snap in debian Michael Hudson-Doyle <michael.hudson@canonical.com> - 2017-10-09 02:20 +0200
                Re: snap in debian Michael Hudson-Doyle <michael.hudson@canonical.com> - 2017-10-09 03:20 +0200
                Re: snap in debian Brian May <bam@debian.org> - 2017-10-15 04:30 +0200
        Re: pycharm package in debian kamaraju kusumanchi <raju.mailinglists@gmail.com> - 2017-10-02 02:30 +0200

csiph-web