Groups | Search | Server Info | Keyboard shortcuts | Login | Register [http] [https] [nntp] [nntps]
Groups > linux.debian.maint.python > #9982
| Path | csiph.com!feeder.erje.net!2.eu.feeder.erje.net!news.etla.org!aioe.org!bofh.it!news.nic.it!robomod |
|---|---|
| From | Julien Puydt <julien.puydt@laposte.net> |
| Newsgroups | linux.debian.maint.python |
| Subject | Re: How to upload my python application .deb file on to debian repository |
| Date | Thu, 23 Nov 2017 06:30:01 +0100 |
| Message-ID | <uOSff-18M-3@gated-at.bofh.it> (permalink) |
| References | <uORjb-wt-9@gated-at.bofh.it> |
| X-Original-To | debian-python@lists.debian.org |
| X-Mailbox-Line | From debian-python-request@lists.debian.org Thu Nov 23 05:26:32 2017 |
| Old-Return-Path | <julien.puydt@laposte.net> |
| X-Amavis-Spam-Status | No, score=-7.088 tagged_above=-10000 required=5.3 tests=[BAYES_00=-2, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, FREEMAIL_FROM=0.001, LDO_WHITELIST=-5, RCVD_IN_DNSWL_LOW=-0.7, SARE_FREE_WEBM_LAPOSTE=0.721, T_RP_MATCHES_RCVD=-0.01] autolearn=ham autolearn_force=no |
| X-Policyd-Weight | NOT_IN_SBL_XBL_SPAMHAUS=-1.5 NOT_IN_BL_NJABL=-1.5 CL_IP_NE_HELO=0.5 (check from: .laposte. - helo: .smtp.laposte. - helo-domain: .laposte.) CL_HOSTNAME_MATCHES_FROM(DOMAIN)=-1.2; rate: -3.7 |
| Dkim-Signature | v=1; a=rsa-sha256; c=simple/simple; d=laposte.net; s=mail0; t=1511414775; bh=yryXfHmw7nha33eWfVRHxyDRa0q2Tz3vHfCSdHEn3Iw=; h=Subject:To:References:From:Date:In-Reply-To; b=fC61iLkK3hhiI6G07HygpYuyyi9ezmtCBq2RYKD5TZFjlShvJXNgT5QD8qvQf1h6r XbNBl7BiAHwZqJv07newW/e+naoi7CeMq7C6hiVMTiyso/bXRzQ9aP2cVbYTWy8GaG JSLW21fnMi+r16brcy4XHZnYvXJCzi1Dd00EojL3BeeeTmGzOci123HvQt+2tflfKh OJrb6x3IOTHo6YgJxUy9NeCKJu7aXfYNPjvIP96p2TtaJxpsbekzzURdH/leYCkCTX eF410of/IISZcgiFpwzq4TE3PVkuyWiXc4xSEsjaO7fhybqdDhuFdcQ7VmE95e8p++ 4zug0QsxMwzOA== |
| User-Agent | Mozilla/5.0 (X11; Linux x86_64; rv:52.0) Gecko/20100101 Thunderbird/52.4.0 |
| MIME-Version | 1.0 |
| Content-Type | text/plain; charset=utf-8 |
| Content-Language | fr |
| Content-Transfer-Encoding | 8bit |
| X-Vr-Srcip | 78.203.229.6 |
| X-Vr-Cause-1 | gggruggvucftvghtrhhoucdtuddrgedttddrkeekgdekudcutefuodetggdotefrodftvfcurfhrohhf |
| X-Vr-Cause-2 | ihhlvgemucfntefrqffuvffgnecuuegrihhlohhuthemucehtddtnecunecujfgurhepuffvfhfhkfff |
| X-Vr-Cause-3 | fgggjggtgfesthekredttdefjeenucfhrhhomheplfhulhhivghnucfruhihughtuceojhhulhhivghn |
| X-Vr-Cause-4 | rdhpuhihughtsehlrghpohhsthgvrdhnvghtqeenucffohhmrghinhepuggvsghirghnrdhorhhgnecu |
| X-Vr-Cause-5 | kfhppeejkedrvddtfedrvddvledrieenucfrrghrrghmpehmohguvgepshhmthhpohhuthdphhgvlhho |
| X-Vr-Cause-6 | pegludelvddrudeikedruddrhegnpdhinhgvthepjeekrddvtdefrddvvdelrdeipdhmrghilhhfrhho |
| X-Vr-Cause-7 | mhepjhhulhhivghnrdhpuhihughtsehlrghpohhsthgvrdhnvghtpdhrtghpthhtohepuggvsghirghn |
| X-Vr-Cause-8 | qdhphihthhhonheslhhishhtshdruggvsghirghnrdhorhhgnecuvehluhhsthgvrhfuihiivgeptd |
| X-Vr-Avstate | No |
| X-Mailing-List | <debian-python@lists.debian.org> archive/latest/15370 |
| List-ID | <debian-python.lists.debian.org> |
| List-URL | <https://lists.debian.org/debian-python/> |
| List-Archive | https://lists.debian.org/msgid-search/e96b7a96-c2ed-d65a-14dc-3ffd309b416a@laposte.net |
| Approved | robomod@news.nic.it |
| Lines | 19 |
| Organization | linux.* mail to news gateway |
| Sender | robomod@news.nic.it |
| X-Original-Date | Thu, 23 Nov 2017 06:26:14 +0100 |
| X-Original-Message-ID | <e96b7a96-c2ed-d65a-14dc-3ffd309b416a@laposte.net> |
| X-Original-References | <CAMGARhUqhEhppiok7t2WyRg212p-b_vwij1tEAbE-1ZayMDfTg@mail.gmail.com> |
| Xref | csiph.com linux.debian.maint.python:9982 |
Show key headers only | View raw
Hi, Le 23/11/2017 à 05:07, quickcal calculator a écrit : > I have developed a Python GUI Application, which i feel will be useful > to all desktop users. Please guide on How to upload my python > application .deb file on to debian repositories. Thanks. You can submit a RFP (request for package) bug, and put this list in CC. See: https://wiki.debian.org/RFP The request generally lists things like the homepage, the license and a description ; see for example: https://bugs.debian.org/cgi-bin/bugreport.cgi?bug=658393 I hope that helps, Snark on irc.debian.org
Back to linux.debian.maint.python | Previous | Next — Previous in thread | Find similar | Unroll thread
How to upload my python application .deb file on to debian repository quickcal calculator <cquickcal@gmail.com> - 2017-11-23 05:30 +0100 Re: How to upload my python application .deb file on to debian repository Julien Puydt <julien.puydt@laposte.net> - 2017-11-23 06:30 +0100
csiph-web